PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010837
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 593aa    MW: 65838 Da    PI: 7.4982
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58693173PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.3e-084991347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
        Lsa010837 49 AWTRQEEESFFTALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 91
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.32E-104296IPR009057Homeodomain-like
PROSITE profilePS5129313.4164596IPR017884SANT domain
SMARTSM007172.7E-64694IPR001005SANT/Myb domain
PfamPF002493.9E-64991IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-54994IPR009057Homeodomain-like
CDDcd001675.13E-64992No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MESQIPFEKE ASTSTQHHDD VFIKDVITSE TNHVASSQPV KKATRQWAAW TRQEEESFFT  60
ALRQVGKNFE KITSRVQSKN KDQVRHYYYR LVRRMNKLLG PELSLDAKNS KDTNAAMLRW  120
WSLLEKHSCK ASKLHLKPRR FKMFLETLEH QLLKDRKKNI RKRSTATQGG NGSHPVKPPR  180
QRRRSGTAPT TTTTTTTDAY KKWEKAAIAG VSLVADAAEH LERTALDKLA DTVQDLQGGD  240
KGSDPIPKTK SIIPPVPIFH QNILSSMKLK LQLFPVDETT RRALEMDNHN PHLELTLSTR  300
KKISSVLEHM TRKWGSSTVA ASGELKLVPY DVQTSNLSNS QKWNQDSLLT AGDVYALIGS  360
PPVFRLRYGW FGKGEESNNG IGIGGSVGMG LSTLDWVDSL TNVSVGDLLS EVSHNAVGPT  420
PCHQQISYSC DSFDAAIAAH INKNHDAKNN GFHSTTIQSS IYDAEETCDA FSFPKNNTDK  480
PQMIPSPSLN QKSPEPEEPK ECEFDENHIP PPKDLTSLTD MYWPESLGAL DLDVASCRYH  540
DTGDVILSDS LGLGGLNCSL DAFQSCSFFG LEKKDTTTLT TLGPPASSSQ GEV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243985.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X3
SwissprotQ8LJT81e-142TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A061EU001e-157A0A061EU00_THECC; TSL-kinase interacting protein 1, putative isoform 1
STRINGGLYMA02G05420.21e-151(Glycine max)
STRINGGLYMA16G23840.11e-151(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.11e-142TSL-kinase interacting protein 1